SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017897 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017897
Domain Number 1 Region: 228-250,355-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000619
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 404-426,454-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000133
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000017897
Domain Number - Region: 194-238
Classification Level Classification E-value
Superfamily RING/U-box 0.00953
Family RING finger domain, C3HC4 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017897   Gene: ENSMLUG00000026985   Transcript: ENSMLUT00000025292
Sequence length 500
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429789:3975843:3977566:-1 gene:ENSMLUG00000026985 transcript:ENSMLUT00000025292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGFLVKRTKRTGGAYRVRLAQRVFPLPEPQGAPPFAKETSRAPRPDAEQAAPSSQEPG
RGLEEAAARELSGSPCRAAGVSPGAGGREGAEWRADGRESPRPSSSPAKPVGVELRRAFL
ERCLRSPASAEPFPGAAAAVAAFSLLSVFCSLTDPRGEQFFLLFRALFPRAHSPIRTPRQ
ISARPRGPGEAAAPPLGEFICQLCKEQYADPLRGWAQHRCSRIVRVEYRCPECDKVFSCP
ANLASHRRWHKPRPAVANATTVSSIDAKLPPSSSPDSGAVASFLAEGKENSRAEQTENQH
LQARDSSGVEPRPDGAPSQGLQVLSHLEAPLPRVPYTEGVLGRRLPGPGSASGAGGPEIF
VCPYCHKKFRRQAYLRKHLGTHEAGSARALAPGFGSERGVPLAFSCPLCGAHFPSADIRD
KHRLWHAVREELLLPALAGAAPEAPSPGGASDGSAQQIFSCKHCPSTFFSSPGLTRHINK
CHPSESRQVLLLQMPLRPGC
Download sequence
Identical sequences G1Q2G4
ENSMLUP00000017897 ENSMLUP00000019357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]