SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017929 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017929
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.09e-51
Family Cyclophilin (peptidylprolyl isomerase) 0.000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017929   Gene: ENSMLUG00000029524   Transcript: ENSMLUT00000028372
Sequence length 153
Comment pep:novel scaffold:Myoluc2.0:GL429896:128101:128802:-1 gene:ENSMLUG00000029524 transcript:ENSMLUT00000028372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVFFDIAVEGKPLSPLADKVPKTAENFRALSTGEKGFGYKGSCFHKIIPGFMCQGD
HFTRPNGTGGKSIYGQKFEDENFVLKRTGPGILSMANAGPNNCSQFFIVTAKTEWMNGKH
VVFGRDIAAAMECFGLRNSKISKKISIADCGQL
Download sequence
Identical sequences G1Q2J6
ENSMLUP00000017929 ENSMLUP00000017929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]