SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017975 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017975
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-19
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017975   Gene: ENSMLUG00000027539   Transcript: ENSMLUT00000023715
Sequence length 866
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429802:9030323:9042220:1 gene:ENSMLUG00000027539 transcript:ENSMLUT00000023715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPQNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMHDKKPAGPGPGPPALLTPPQPGLHNPAAQYTPMLPVAYPSQSDSIYLVPTPSKT
QQGLYQAPGPSPQFQSPPAKQTSTFSKQVPHHPFPSPAPDLYQVPPGPGNSTQDIYQVPP
SAGMGLDIYQVPPSMDARSWEGTKPPPKVVVPTRVGQGYVFEASQPEQDEYDIPRHLLGP
GPQDIYDVPPVRGLPSQYSQEVYDTPPMAVKGPNGWDPSLDVYDVPPSVEKSLPPSSHHA
VYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPTRHPLVLAAPPPDSSPAEDVYDV
PPPAPDIYDVPPGLRRPGPSTLYDVPRERVLPPEVADGSAADDGVYVVPPSAEREAPADA
KRLSASSTGSTRSSQSASSLEAPVPGREPLELEVAVEALTRLQQGVSATVTQLLDVASSA
GRGGGWRSTTEPQEPPAQDLRAAVAAVQGAVHELLEFARSAVGNSAHTSDRTLNAKLSRQ
LQKMEDVYQTLVAHGQTFDSSRGGPGATSEDLDRLVACSRAVPEDAKQLASFLHGNASLL
FRRTKAPVSGPEGGGSLHPIPTDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDY
DYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLTNWTS
AQSLAPGRTGSLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKF
VILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPTAAQ
DMVDRVKELGHSTQQFRRVLGQLAAA
Download sequence
Identical sequences G1Q2P2
ENSMLUP00000017975 ENSMLUP00000017975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]