SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018030 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018030
Domain Number 1 Region: 306-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-53
Family SPRY domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 21-94
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-19
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 105-164
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000366
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018030   Gene: ENSMLUG00000023548   Transcript: ENSMLUT00000023649
Sequence length 487
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429898:2601856:2625084:1 gene:ENSMLUG00000023548 transcript:ENSMLUT00000023649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQQPPCSSAPVSAAPGAMACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQE
AQGARDCPECRRTFAEPAFAPSLKLANIVERYSAFPLDAILNARRAARPCQAHDKVKLFC
LTDRTLLCFFCDEPALHEQHQVTGIDDAFEELQDKLKEQLQALQDSEREHTEALQLLKRQ
LAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLR
KVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIW
KSLFQDIHPVPAALTLDPGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGS
EAFSGGVHYWEVVVAEKTQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEP
WTRLNVRDKLDKVGVFLDYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGK
NVQPLRI
Download sequence
Identical sequences G1Q2U7
ENSMLUP00000018030 ENSMLUP00000018030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]