SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018034 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018034
Domain Number 1 Region: 237-423
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-46
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 4-229
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-21
Family Voltage-gated potassium channels 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018034   Gene: ENSMLUG00000023781   Transcript: ENSMLUT00000028950
Sequence length 429
Comment pep:novel scaffold:Myoluc2.0:AAPE02064132:804:11461:1 gene:ENSMLUG00000023781 transcript:ENSMLUT00000028950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLMYILWLFFVVLAWNWNCWLIPVRWAFPYQTPGNLYFWLLMDYLCDLIYFLDITVFQMR
LQFVRGGDIITDKKEMRNNYLKSPRFKMDLLCLLPLDLLYLKFGVNPLLRLPRCLKYMAF
FEFNNRLESILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGIGSTHWVYDGVGNSY
IRCYYWAVKTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTY
YRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESDLMVQLPDKMRLDLAIDV
NYDIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGG
PDGKSVLVTLRAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPES
QKLLRKKAR
Download sequence
Identical sequences G1Q2V1
ENSMLUP00000018034 ENSMLUP00000018034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]