SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018072 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018072
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-18
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018072   Gene: ENSMLUG00000022512   Transcript: ENSMLUT00000026026
Sequence length 259
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430006:194114:194893:-1 gene:ENSMLUG00000022512 transcript:ENSMLUT00000026026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNERSVAHYALSNSPADHRGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREA
RAPLGLVVLEGCTVELAEAPVPEEFAFTICFNAPGVRPYLLAADGPAAQEAWVKVLSRAS
FGYMRLVVRELENQLRDARQGLALHRHSSWKAGTSPCKTQPPDQLSRGLENGHTLSRDYS
PMGLVEAGGSRPAGRSLAECELQGAASLLLGRGQSPVSPETSCFSTLHDWYGQEILELRR
GWQQRARGSQPKCEQQDKP
Download sequence
Identical sequences G1Q2Y9
ENSMLUP00000018072 ENSMLUP00000018072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]