SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018076 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018076
Domain Number 1 Region: 236-320
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-25
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-21
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 123-219
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-21
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 4 Region: 352-448
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-20
Family PDZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018076   Gene: ENSMLUG00000028785   Transcript: ENSMLUT00000028917
Sequence length 510
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429957:47760:60268:-1 gene:ENSMLUG00000028785 transcript:ENSMLUT00000028917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTFSPRECKLSKPEGQSYGFFLRIEKDTDGHLVRVVEKGSPAERAGLQDGDRVLRING
VFVDKEEHKQVVDLIRNSGNSVTFLVLDGDSYEKAMREKVDLKELGQSQKGPSLNDKKLP
PVMNGGAQAWTQPRLCYLVKEGGSFGFSLKTVQGIKGVYMTDITPQGVAMKAGVLADDHL
IEVNGENVEDATHEEVVEKVRKSGSRVTFLLVDKETDQHHRELNIKLKRETASLKLLPHQ
PRVVEMKKGSNGYGFYLRAGPEQRGQFIKDIDSGSPAEEAGLKANDLLIAVNGESVESLS
HDSVVEMIRKSGDQTSLLVVDKETDSIYRLAHFSPFLYYQSQQLPNGSVKEALVPAPLAS
SSPDHKPKLCRLVKGDNGYGFHLNAIRGQPGPFVKEVQEGSPAQLAGLEDEDVIIEVNGV
NVLDELYEKVIDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSMADPLDVPLVSKEETW
VESELDSHVAKERAHSTASQSSSNSEDTRM
Download sequence
Identical sequences G1Q2Z3
ENSMLUP00000018076 XP_006096930.1.53796 XP_006096931.1.53796 XP_014318249.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]