SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018078 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018078
Domain Number 1 Region: 10-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.76e-21
Family Ubiquitin-related 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018078   Gene: ENSMLUG00000027145   Transcript: ENSMLUT00000027057
Sequence length 171
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429807:151565:152537:1 gene:ENSMLUG00000027145 transcript:ENSMLUT00000027057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVLAWVDAAAAAMQLTVKALQGRECSLQVSEDELVSTLKHLVSEKLNVPVRQQRLLFKGK
ALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEESATQKLAEAPPLRPPAWQLIAKVLARH
FSAADANRVLDQLQRDYEKSLSRLTLDDIERLANRFLNPEVTEVKEKGFSK
Download sequence
Identical sequences G1Q2Z5
ENSMLUP00000018078 ENSMLUP00000018078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]