SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018134 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018134
Domain Number 1 Region: 182-240
Classification Level Classification E-value
Superfamily SH3-domain 0.000000643
Family SH3-domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000018134
Domain Number - Region: 116-159
Classification Level Classification E-value
Superfamily SH3-domain 0.0011
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018134   Gene: ENSMLUG00000024492   Transcript: ENSMLUT00000026372
Sequence length 359
Comment pep:novel scaffold:Myoluc2.0:GL431193:55129:56271:1 gene:ENSMLUG00000024492 transcript:ENSMLUT00000026372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVTVIGAKLPKMTRNLINIKMNQHMWLLNDSKMWWRVRRWPTGQTMVLSIYMERKNGL
KKGSLMKNLKNTLSLGNTKRKTSMWDSSLIPYTDAEYPAKGEVANRIYDLNILDFVKFAY
MTERLGDLSLVKGSCVTALETCSNGWMWQLQRAVGPVPFQQHPEEVGSWPPSSKLTQLAE
GLIPCVLHVVHKVYLFSLATEKLKFEKGETVKVIEKPGNDQERWKCKNAWGQAGLPPNYV
VVLSHGPALSTLHAPYISYPGRGSGCFADREWYYGNTHHQARCVLNRGAGGDILIGEGES
SPSDLVSLIAPGKNEHYKLQLVKSVNCITQQQFPTMDLLKGPHPHRGHGEKLYLIRALQ
Download sequence
Identical sequences G1Q351
ENSMLUP00000018134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]