SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018182 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018182
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.84e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0083
Further Details:      
 
Domain Number 2 Region: 278-343
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000187
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 562-676
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000124
Family Ankyrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 776-821
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000366
Family MYND zinc finger 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018182   Gene: ENSMLUG00000004589   Transcript: ENSMLUT00000028799
Sequence length 821
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:736901:768813:-1 gene:ENSMLUG00000004589 transcript:ENSMLUT00000028799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVQEWQDGCVYRGHFGLDMKLGYGEFSWPTGESYHGQFYRDHRHGFGTYMWPDGSSFTGM
FYLSFREGYGTMYMKTRLFQGLYKADERFGPGIETYPDGSQEVGLWFREHLIKLCTEIPC
SVSISSYPEFQGFLTHSPARISLSEEETMHWDLQEERDPFFYNYKQFLLNDDLTLPPDVY
LYSTDNTHMPITRSFRRDLDSRIFLHDIPPFVEDGEPWFIKNETPLMVKIQKHTYKFRNK
KEHSSWNMGAILEGDRSGFACRGPKERLAKEMILKAEEGNYDWIYGILRDNLASPDVADA
RGYTVLAAAAIHCHINIINLLLDNGADVNKCTDEGLTPLNMCFLLYYPATSFRPNIAERT
VPEPQVSHGPHRPGSVSTVHLPPSLRSHLPPSPLCLPSCPPASPPHTDQVQMGHRGQAVC
RHSVTSSQDLLQLVCIAGLESRQTPRPPNLKYLQKSMLKVPSPEAISDKGTMRQMAWTMT
KLFMTHVHLGTISVRQSVYMTKSRHHRSTRRIPLGGSGAARRLIDALCTQTRLAVPQHMC
GSPVMKLNNEVGPPRVYSSVNMSVPEEGGRTPLHVACEREDNYRYARDVVHLLLSNRANS
SLLWGGHSPLSLSIASGNDLIVKELLTNGADPNLPLTKGLGNALCVACDIAYEHRRSVNS
RLGLIDLLINYGADILAPVTLTQGDKVAVGTAVDYGYFKFFQDRKIAHCPFHTLMPAERE
TFVARKRLLEYMGFQLRSAIMAKESLWDPKVLCLSKKGDTESVDGTEKGLQMGRTPFFKF
CYQCGRSIGVRLLPCSRCYGILTCSKSCKTKAWADFHGRDC
Download sequence
Identical sequences G1Q399
ENSMLUP00000018182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]