SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018196 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018196
Domain Number 1 Region: 50-214
Classification Level Classification E-value
Superfamily Ferritin-like 1.72e-57
Family Ferritin 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018196   Gene: ENSMLUG00000030744   Transcript: ENSMLUT00000022762
Sequence length 219
Comment pep:novel scaffold:Myoluc2.0:GL430438:131420:132079:-1 gene:ENSMLUG00000030744 transcript:ENSMLUT00000022762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIPASCPDLASCQPPHRALRQSQGPRHHSNAAQPPLLSTHHNDDRAHHAGGSELPPGLRG
LINVELYVSSVCLSMSYYFGRDDVALKNLAKYFLRQPHEEREHAEKLTKLQTQRGGRIFL
QDIKKPDHDNWENGLNAMECALDLGKGVNQSLLDWHKVATDKNDPHLCDFTETHYLNEQV
KPIKELGDDVINLCWLGAPEIGTVEYLFDKHTQGDSAES
Download sequence
Identical sequences G1Q3B3
ENSMLUP00000018196 ENSMLUP00000018196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]