SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018248 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018248
Domain Number 1 Region: 125-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-69
Family Protein kinases, catalytic subunit 0.000000000307
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-29
Family Regulator of G-protein signaling, RGS 0.00000355
Further Details:      
 
Domain Number 3 Region: 484-592
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-24
Family Pleckstrin-homology domain (PH domain) 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018248   Gene: ENSMLUG00000029651   Transcript: ENSMLUT00000026679
Sequence length 618
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429996:2086843:2130037:1 gene:ENSMLUG00000029651 transcript:ENSMLUT00000026679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLSRSRQIYDTYIMKELLSCSH
PCTLDIYIYISKRLXKKQVTSALFQPYIEEICESLRGNIFQKFMESDKFTRFCQWKNVEL
NIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIM
LSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEII
LGLEHMHHRFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGTHGYMAPEVL
QKGTAYDSSADWFSLGCMLFKLLRGNAPGRRERNRISHSTENVITYIPSLTFKELVSPHA
KVALKSQLPRSFKNMAKSKNSGFYGVDQADAHFVKYPPPLIPPRGEVNAADAFDIGSFDE
EDTRGIKLLDCDQELYKNFPLVISERWQQEVVETIYETVNSDTDKIEARKRAKNKQLGHE
EDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQIMSVE
ETQFKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETFTEAQRLLRRAPKFLNKSRA
GVVELAKPPLCHRSSNGL
Download sequence
Identical sequences G1Q3G5
ENSMLUP00000018248 ENSMLUP00000018248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]