SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018295 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018295
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.53e-18
Family BCR-homology GTPase activation domain (BH-domain) 0.0026
Further Details:      
 
Domain Number 2 Region: 208-326
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000141
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000018295
Domain Number - Region: 126-182
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0568
Family Ubiquitin-related 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018295   Gene: ENSMLUG00000023720   Transcript: ENSMLUT00000028000
Sequence length 382
Comment pep:novel scaffold:Myoluc2.0:GL429774:16413142:16420689:-1 gene:ENSMLUG00000023720 transcript:ENSMLUT00000028000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEDKEEKVSRYRGLLACLPSVNRATVKALISHLYCVQCFSDMNQMNTHNLAIVFGLTLFQ
TDGQDYKAGHVVEDLINHYVVMFSVDEEELRKQQEEVTAIAKMRVADTASGTQKAEAKQH
IKIPASSMTAEELTLEILDCRNVSIREKDYWTCFEVNERKETERPLHFSEKVLPILHGLG
IDSYLVVKKYQSMEAMLLYLASHVGETKHGMMKFREDRSVMGLGLGLPSGGFQDRYFSLN
SSCLRLYKEIWSQRPWSGASETSHRPEKEWPMKSLKVYLGVKKKLRPPICRGFTMVHETK
KQEKQQWYLCCEAQMELPEWFATFLFVQHDGLVWPSEPSRVSRVVPEVRMGSVSLIPLGN
ENEMRRSVAAFAADPLSLLRNV
Download sequence
Identical sequences G1Q3L2
ENSMLUP00000018295 ENSMLUP00000018295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]