SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018372 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018372
Domain Number 1 Region: 43-224
Classification Level Classification E-value
Superfamily Ferritin-like 4.06e-49
Family Ferritin 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018372   Gene: ENSMLUG00000011420   Transcript: ENSMLUT00000011417
Sequence length 230
Comment pep:novel scaffold:Myoluc2.0:GL429787:8437844:8439455:-1 gene:ENSMLUG00000011420 transcript:ENSMLUT00000011417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVLPQAGRPAVAQLPSRSLWVRPPKSLTLGRLGGPRRRRLAQPMTTPPRRSQALDSYHP
ACEAAVNHQIHLELYVIYVYKSMATYFEENQVTLKYVGKFFLGQAAQMKEHVDRLIHLQN
QRSGQTRVYEGNIDTPDYNYWDSGLKALEHALDLAMNVNQNLLYIHQLAMAKNDARLSDF
LEHNCVYDQVKSIKELRDHISNFPQAGGSGSNMTEYLFDKLTLGNSDHRK
Download sequence
Identical sequences G1Q3T9
ENSMLUP00000018372 ENSMLUP00000018372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]