SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018414 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018414
Domain Number 1 Region: 184-428,484-568
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.67e-95
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000138
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000018414
Domain Number - Region: 735-798
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000531
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018414   Gene: ENSMLUG00000023786   Transcript: ENSMLUT00000031055
Sequence length 1379
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429828:2621388:2691412:-1 gene:ENSMLUG00000023786 transcript:ENSMLUT00000031055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRSGHQGRAVKGDQDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDITNSKTVNER
ITLNLPASTPLRKLFEDVANKVGYINGTFDLVWGNGINTADMAPLDHTSDKSLLDANFEP
GKKNFLHLTDKDGEQPQIMLEDSSTGDDSAHDRLIGPLPREGSVGSTSDYVSQSYSYSSI
LNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRL
FVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINE
LYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGP
NQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMST
FIDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLENNSGTEKISKPG
LEKNSLIYELFSVMVHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIKKTHGGS
SGSRGYYSSAFASSTNAYMLIYRLKDPTRNAKFLEVDEYPEHIKNLVQRERELEEQEKRQ
REIERNTCKIKLFCLHPVKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPVDCCRLV
KYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPGDVTEVMV
KVHVVDLKAESVAAPVTVRAYLNQTVTEFKQLISKAIHLPAETMRIVLERSYNDLRLLTV
PSKTLKAEGFFRSNKVFVESSETLDYQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSY
SKRTAYQKAGGDSGNVDDDCERVKGPVGNLKSVEAILEESTEKLKSLSLQQQQDGDNGDS
SKSTETSDFENIESPLNERDSSTSVDNRELEQHLQTSDPENFQSEERSDSDVNNDRSTSS
VDSDILSSSHSSDTLCNADNAQIPLANGLDTHSITSSRRTKANEGKKETWDTAEEDSGTD
SEYDESGKSRGEIQYMYFKAEPYATDEGSGEGHKWLMVHVDKRITLAAFKQHLEPFVGVL
SSHFKVFRVYASNQEFESVRLNETLSSFSEDNKITIRLGRALKKGEYRVKVYQLLVNEQE
PCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIY
EEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWRPSEMKLDPFQEVVLESSSVDELR
EKLCEISGIPLEDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIF
YRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences G1Q3Y1
ENSMLUP00000018414 ENSMLUP00000018414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]