SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018531 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018531
Domain Number 1 Region: 303-355,384-587
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.67e-39
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 11-125
Classification Level Classification E-value
Superfamily ARID-like 3.66e-29
Family ARID domain 0.001
Further Details:      
 
Domain Number 3 Region: 241-299
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-16
Family PHD domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1090-1158
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000555
Family PHD domain 0.02
Further Details:      
 
Domain Number 5 Region: 1410-1471
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000411
Family PHD domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018531   Gene: ENSMLUG00000024285   Transcript: ENSMLUT00000025297
Sequence length 1477
Comment pep:novel scaffold:Myoluc2.0:GL430575:22590:46180:-1 gene:ENSMLUG00000024285 transcript:ENSMLUT00000025297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERK
ILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILHPYSLFL
SGDSLRCLQKPNLATDTKDKEYKPHDIPQRQSVQPVETCPPARRAKRMRAEAMNIKIEPE
ETTEARTHNLRRRMGCPTPKYENEKDMKSSIKQEPMEKKEHLLESEREKPKSRPKKTTSA
VDLYVCLLCGSGSDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDWRCPKCVAQECSKPQE
AFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYG
ADIASKEFGSGFPVRDGKVKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPW
LYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLESVMKRLAPELFVSQP
DLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVD
WLPLGRQCVEHYRLLHRYCVFSHDEMICRMAAKAGVLDVVVASTVQKDMAIMIEDERALR
ETVRKLGVIDSERMDFELLPDDERQCIKCKTTCFMSAVSCACKPGLLVCLHHVPELCACP
PGKYKLRYRYTLDDLYPMMNALKLRAESYNEWAVTVNDALEAKISKKQSLASLKALIEES
EMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRFRSGGGKSPNQLTVSELRQFV
TQLYALPCALSQAPLLKDLLSRVEDFQQQSQKLLSEEAPRAAELQELLDVSFEFDVDLPQ
LTEVRVRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYAAVEKAMARLQELLT
VSEHWDDKAKSLLRARPRQSLTSLATAVKEMEEIPAYLPSGAVLKDSVQRARDWLQDVEA
LQAGGRVPVLDTLVELVTRGRCIPVHLSPLPRLESLVAEVQAWKECAANTFLMENSPYSL
LEVLCPRCDIGLLGSKRKQRKLKEPLPNGKKRSSRLESLSDLERALAESKETAAAMAALG
EARLREMEALQSLRLANEGKLLAPGREAETKVCLCQKAPAAPMVQCELCRDAFHTGCVAV
PGASPGPRVWLCPLCRRSEKPPLEKILPLLASLQRLRVRLPEGDALRYMIERTVSWQHRA
QQLLASGSLTPMQAHTGPGMSHGRWPAAAGPASETSKAPQPPGTASSEPGDQDSRSSSLQ
APFSVGWSCIPLHGVSPEVSELLMEAQLLQVTLPEIQELYQTLLAKPSPAQQTGRSSPGR
PGSEKSDCCRAKREGSSSLERRLKRRPERDGLAGERWGQVRKVWAPGRKRIRLGPPQDTD
TFQLESERGYAPVRSADTHSLPSDTSSSEQEDSEDEDAICPAGSCLQPEGDEVDWVQCDG
SCNQWFHQVCVGVSPETAAKEDYVCARCAGTAAPSRK
Download sequence
Identical sequences G1Q498
ENSMLUP00000018531 ENSMLUP00000018531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]