SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018532 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018532
Domain Number 1 Region: 492-566
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000012
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018532   Gene: ENSMLUG00000006719   Transcript: ENSMLUT00000024457
Sequence length 590
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430395:109278:114342:1 gene:ENSMLUG00000006719 transcript:ENSMLUT00000024457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHQDFRSLQAKFQASQPETSELPLKSPKPEFKKLLKKFPQPEPSEHSKKPSPPEFTDLP
RKPPQPEFIAVPRKPPQPKFTHLPKKPSKSEFSELHKKFPELEATVLPRKPLQPEVSEAP
QKALQLEPSALAQKPQQPDLSNPIRPPTEPKLSTFPRKFWQPESNEAILTASQPEFSNFP
KKPPPLEFRKPQQPQMPPWKPEPSEPHPNFSQPDFSAFPKKTPPPQLSNLPRKALQLESG
DLTRTSSEPEVCVFPKRPQQSEFKALSKPPKPKLSSLPRTSSEPEPETNALPKKPRQAEF
FGDPSRKPPLPGSVSESSLPMAVAGSGPRFPLSPGFGARQKKSGVLTHGGGSRLGLKPGH
PPRQRPLPPVSSLGPPPAKPPLPPGLKDVQCFQRPSAAITTLQKTCSSAGIHFQARQPKA
ILKDQEEIYELYDDVDLTDSSPSTKGKDEVPSIQQPPRKPPQDPELRKEKAPQPQQLLLV
DPKTLKKIRKAEKAEREFRKKFKFEGEIVIQTKMMIDPNAKTRRGGGKHLGIRRGEILEV
IEFTNKEEMLCRDTKGKYGYVPRTALLPLETEVYDDVGFLDPLESQPFPR
Download sequence
Identical sequences G1Q499
ENSMLUP00000018532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]