SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018549 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018549
Domain Number 1 Region: 1031-1067,1151-1246,1348-1594,1643-1679
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-39
Family Tandem AAA-ATPase domain 0.055
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000158
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 
Domain Number 3 Region: 184-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000442
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 446-591
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000147
Family Ankyrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018549   Gene: ENSMLUG00000003537   Transcript: ENSMLUT00000029595
Sequence length 2911
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429962:1406789:1456658:-1 gene:ENSMLUG00000003537 transcript:ENSMLUT00000029595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWEQRIWKVPPRDLAVLLCNKSNAFYNLGKWNEAFVAAKECLQWDPTYVKGYYRAGYSLL
QLLQHYEAARMFFEGLQLLQGSSDQSQFADFLVGVFTTMGSDPIVLQSFLPYFDHIFTIG
FSTEVWQSVIEKLAKKGLWHSFLLLSAKKDRLPRNIHVPELSLKSLFEKYVFIGLYEKME
QVPKLVQWLISIGASIETIGPYPLHALMRLCIQARENHLFRWLMEQQPEWKGRVNQKDQD
GCTVLHVVAAHSPGYLIKRQTEDVQMLLRFGADPTLLDRQSRTPVDVLKRNKNFKAIEKI
NSHLEKLAACSKDLSGLSHGEGPSSESNIFREASAQLVKYLNSGNRLLHKNFLKQDVVQK
FLRLLSSLQEIPPDLVCDINRDCANTFVKCLLEKQKWPEVLLLLTRKVSGEPPLGDRLIK
DCDFSGLDLCAIIPPLSTWDQRRVQLLGRLVDGGALPEGLQDSQARPLAVCLQHQDFELA
FLLLTKGADPRVISLTEGDTPLHAALHIFLDVNADIGFNFLNHLLDLFWSNPAKFDYLNP
NTQDSSGNTLMHLLFQRGMLKRMKKLLDLLAKFDINFNLKNKEGKDARHRIKKNAPLLLA
WNKAVAESRRRSRQDPAAHLGKFPKNAVPGQTAQLKSQVPSDSLLCGDPDRPLPEGAVVP
DSWETLSDAQMARQESGVARPCSQRDRLVQHIMRLIEKVELDMSLPEDCPQDSKPLEIGA
VTETKREELQRTLGVGGSDCGGNSPAVPEAGGGHAQAGLGTSQLTPAGHRGGEDTSDQDS
CQEVEACLQDFENMTWEIECTSEMLKKLSSKVMTKVMKKKIILTIHQLGNGEWTQGLQKR
LKHLKGNIQLFEAKLDKGARMLWELAIDFSPRCSENPEKIITTERSSHPMEKSGRVYTEI
IRIWDIVLDHGKLTDSIRAICSAYNRGLSCILRKKLRGINKGQVSANMRIRKRIPRCYVE
DTEAEKGRVPVEPQYFPPASAVQTEYNVMKFHSFSSNMAFNILNDMTATVEYPFRVGELE
YAVIHLNPRPLEPIILIGRSGTGKTTCCLYRLWKKFHIYWEKAEQAGSPLLAKQVWLKRR
LEVEPRKEGPGEEEEEEKEEDEEEEGSIEVETVDSIDEEQESGACAGTASEDPGGPSQVA
EVCAPEGPQQLEHLHQIFVTKNHVLCQEVQRNFIELSKSAKATSHYKPLEPNVHKLQDLR
DENFPLFVTSKQLLLLLDASLPKPFFLRNEDGSLKRTIVGWSTQEELTIPNWQEEEEEAE
GDGDNVEEDKVAETRSCDVDPRVYVTFEVFTNEIWPRMHKGKTSYNPALIWKEIKSFLKG
SFEALSSPEGRLTEEEYKKLGRKRSPNFKEDRSEIYNLFCLYQQIRSQKGYFDEEDVLFN
LSRRLSKLKVLPWSIHELYGDEIQDFTQAELALLMKCINDPNAMFLTGDTAQSIMKGVAF
RFSDLRSLFHYASRSTGDKQCAVRKPKKIHQLYQNYRSHSGILNLASGVVDLLQFYFPES
FDRLPRDSGLFDGPKPTVLESCSVSDLAILLRGNKRKTQPIEFGAHQVILVANEMAKEKI
PEELGLALVLTVYEAKGLEFDDVLLYNFFTDSEAYKEWKIISSFTPSSPDSRETSGPLID
VPLDKPSSSQGRSLVNPEMYKLLNGELKQLYTAITRARANLWIFDENPEKRAPAFKYFIR
RNFVQVVKTDENKDFDDSMFVKTSTAKEWIAQGEYYAKHQCWKVAAKCYQKGGAFEKEKL
ALAHNTALNMKSKKVSPKEKQMEYLELAKTYLECNEPKLSLKCLSYAKEFQLSAQLCERL
GKIKDAAYFYKRSQCYQDAFRCFEQIQEFDLALKMYCQEELYEEAAVAVEKYEAMLRSKT
LPVSKLSYSASQFYLEAAAKYLSANKIKEMMAVLSKLDVDDQLVFLKSRKRLAEAADLLN
REGRREEAAMLMKQHGFLLEAAKLTADKDFQASCLLEAARLNVARDSDVEHTKAILREAL
DLCYQTNQLFGIAEAQFLLGVILKDFQNLKDAFFKFDTLNHSAGVVEALYEATSHCEADP
QKVLALAPGGLEVLLNLVRALKRVTNNAEKDMVKFCFEFFGISQVDAKYCQIAQNDPGPI
LKIIFDLDLNLKEKKTKDHFLIMTDQVKLALNKHLFSRLCQITQSLLRKTYPGICLRFIV
GLKCEDGNCEDYHRPLRRCEAKCLVQSKMHQVAINGLLLEAKKVFPKSLAEELEQIDYIL
SADKYGHCKSFLSVVFPKHFHQRVLSENPMACKEILKPNYKSFRSYRFALKEYIYFLFQN
ERARSRRESTDLWLSAMQAFLLSSSYPEEFGKLLHQEEDNYHRELKALALEKEERGRGRG
SRMKGIEGKFGMLAPNKDDESTEKTHLCFIRLLENCIDQLYVYRNPENYKRLFFRFMNVL
VKRCKEPLIPSIGNTVALLEFQFVHCGVVLARLRKSAILCLPKSYIALLHYWEFLFSKRD
KEFGDVFSIIQDYKPKDVTRAIQDFRFHLSYLVKVLCGYENVNFNVLLDAFSDIDCVVSG
EAERTLVLCLVMLVNAEVVLQPFCKSLLYRHFQEIEKRLQLMSVDYPDQVPERLRDVVKR
VLMAADVKSVAEALQDLLFERDEEYLMDCHWRWDSGHTKGVTVRGLYHEEGQDETDELAL
EDRDHLLATILSQKQRKASIQRKLRRACLVVALCISWKRRVSAQMGCPREETREPGTGIF
KKADVDRTQCDLCGVKFTRSPENYFSPSKAFEGETSEAVALSEAELGDKEGRERNSESYE
HHIHLEGHQRQQMAYQKYSEFFHEKVDPAIDEGKLVVQDIEQSVWIRSHLGSKEHSLMLQ
RKVQENIRKVSDAVEDLYRQKAWAGAKEVMTRLVNVLIPSVKDAREWLKKTELHLKEEGI
VQEDEYENEIEDFGELRPRRRSRKCGKQRKY
Download sequence
Identical sequences G1Q4B6
ENSMLUP00000018549 ENSMLUP00000003229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]