SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018597 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018597
Domain Number 1 Region: 18-145
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.51e-44
Family Cyclophilin (peptidylprolyl isomerase) 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018597   Gene: ENSMLUG00000008881   Transcript: ENSMLUT00000008877
Sequence length 145
Comment pep:novel scaffold:Myoluc2.0:GL429821:5137761:5138198:-1 gene:ENSMLUG00000008881 transcript:ENSMLUT00000008877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRCHCPREPSSTRDSRKLHALSTGGKGFGYKASSFHRIILGFMCQGDNFTRPNGTGDKSI
YGEKFDDENFILKHTGPGILSMANAGPNINRFQFFICTAQTEWLDGETVVFRYMEDGMDI
VLAMERFGFKNGKTSKITIAGCGQL
Download sequence
Identical sequences G1Q4G4
ENSMLUP00000018597 ENSMLUP00000018597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]