SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018599 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018599
Domain Number 1 Region: 271-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-43
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000596
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Domain Number 3 Region: 76-135
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018599   Gene: ENSMLUG00000023216   Transcript: ENSMLUT00000002218
Sequence length 439
Comment pep:novel scaffold:Myoluc2.0:GL429784:9980320:9981636:1 gene:ENSMLUG00000023216 transcript:ENSMLUT00000002218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLICLDYLRDPVTTECGHNFCSSCIHQRWEGLQGTFPCPACLHHCPDRSLKMNTQLCHM
TEIVQQITGMGGKRKKQEEPRCKKHHESLALFCGKDLELLCAQCSVSSDHRDHPLMPIEE
AAATHRRKLKSYIDSFTEQIKDTENWSEMQISKCFELRQRIEHQKDELHSEVKQLKNFLE
KEQNAVLSSLLTETTNVEEKLMEEKNQISNHSSILNSQLGDIINKCLQTDVDLLTVNESI
HNRYNLETLAIFSYELKEESCSLPPHYFGLHKMIHTFQVDLTLDPETAHQSLSISRDRKS
VTQRTSFGLQNLHVRTFYPAVLSSKGFDAGRHFWQVEVRGTGAWSFGVCKESFPKNTPMR
PSPRNGCWQLQFWTNTSDKRDSGNWERIGIFLDYELGEVSFYNLRNRSHLYTFRERFTVK
LMPYFCLGPSSKSLVMGIV
Download sequence
Identical sequences G1Q4G6
ENSMLUP00000018599 ENSMLUP00000018599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]