SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018635 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018635
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Ferritin-like 1.25e-55
Family Ferritin 0.00000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018635   Gene: ENSMLUG00000023224   Transcript: ENSMLUT00000024040
Sequence length 182
Comment pep:novel scaffold:Myoluc2.0:GL429798:3813634:3814182:1 gene:ENSMLUG00000023224 transcript:ENSMLUT00000024040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPRPVSQVRQNYRADCEDCLNHQIYVELHASYVYLSIAFYFDRQDQALQHFAAFFLGQS
REEWKHAQTLMRLQNQRGGRICLRNILGPEQSQWESGLEAMESALEMARMVTQSLRNLHL
LATMKNDAHLRAFLVRHFLRQDVQLVYNLGASVSQLRKLGAPTSSLAESLFDTLALGART
EN
Download sequence
Identical sequences G1Q4K2
ENSMLUP00000018635 ENSMLUP00000018635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]