SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018702 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018702
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.65e-31
Family Ubiquitin-related 0.00000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018702   Gene: ENSMLUG00000025342   Transcript: ENSMLUT00000029070
Sequence length 95
Comment pep:novel scaffold:Myoluc2.0:GL430252:139463:150552:-1 gene:ENSMLUG00000025342 transcript:ENSMLUT00000029070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MXXXXQQEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Download sequence
Identical sequences G1Q4R9
ENSMLUP00000016250 ENSMLUP00000018702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]