SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018789 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018789
Domain Number 1 Region: 84-367
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.81e-60
Family gamma-Butyrobetaine hydroxylase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018789   Gene: ENSMLUG00000023363   Transcript: ENSMLUT00000029644
Sequence length 387
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429859:381318:427228:1 gene:ENSMLUG00000023363 transcript:ENSMLUT00000029644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCAIQKAEVLDGAHLMQILWQDGTESFYPAVWLRDNCQCPHCYLDSAKARKFLVESLDV
NIGIKDLSFDRKRVLITWPSEHYSEFEADWLKKRCFSQQAREKLQRELFFPECQYWGSEL
QLPTLDFEDVLKNDEQAYKWLSSLKRVGIVRLTGASNKRGEVVKLGKRIGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCRQ
LQEKNPRAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVIRINFNNATRDTIF
DVPVEKVQPFYAALKEFVDLMNCKEFKFTFKMNPGDVITFDNWRLLHGRSSYEAGTEISR
HLEGAYADWDVVMSRLRILRRSVQNRN
Download sequence
Identical sequences G1Q506
XP_006091653.1.53796 XP_006091654.1.53796 XP_006091655.1.53796 XP_006091656.1.53796 XP_014313749.1.53796 ENSMLUP00000018789 ENSMLUP00000018789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]