SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018812 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018812
Domain Number 1 Region: 271-402
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-32
Family Ran-binding domain 0.00000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018812   Gene: ENSMLUG00000002697   Transcript: ENSMLUT00000027357
Sequence length 457
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429835:1769997:1793170:-1 gene:ENSMLUG00000002697 transcript:ENSMLUT00000027357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKSVIAQPIFVFEKREQSFKRPAEETLHEAAEPECNGFSRKRIRASSFSLQTTDSQSQGG
RIISDFVCLSSTFNALRYFPSTRRVKKNNVFMTPTIVQRSVDMNSAEQSPLKHSEHVLRP
AILQPPRAQRCEKVRHHALEHCKTKEQTKNKISEKNSSLLSENMPSAGISIQLSTNQILL
GAASVGCQPNEDKYSFKSCSSDFVFGENMVERVLGMQKLTQPQLENDSYAKEKPFKYNLK
FPINSPNSRTDAIKNMSLIESAAALSSKSSPKCLLKKIDVITGEEAEYNVLKINCKLFVF
NKTTPSWTERGRGALRLNDTAGSDRGAFQSRLIMRNQGSLRLILNSKLWTQMEIQRANPR
NLRVTATDLEDYSIKVFLIQATAKDTESLYAAIHHRLVALRSFEKQKDINQADSQAEAAL
PQLNCDSCDEDEDGFTQGTKNRSDPSRWTHRQSVACS
Download sequence
Identical sequences G1Q529
ENSMLUP00000018812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]