SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018851 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018851
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.14e-18
Family Ribosomal S5 protein, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 177-255
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000202
Family Translational machinery components 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018851   Gene: ENSMLUG00000026194   Transcript: ENSMLUT00000026382
Sequence length 290
Comment pep:novel scaffold:Myoluc2.0:GL430157:264922:265819:-1 gene:ENSMLUG00000026194 transcript:ENSMLUT00000026382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMDDAGAAGGPRVGGRGVGIGGLGGFCGGFGSVIQGLGGGWGRGRGRGRGAGKDKDKEWI
PVTKLSRLVKDMKIRSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQR
TRFKAFVSTGDYNGHVGLGAQCSKEGATAIRGAIILANLSIVHGPRGYWGNKLGKPHTVP
CKVVGCGSVLGRLIPAPRGTGIVSVPVPKKLLLMAIDNCYTAARRCTATLGNFARATFDA
ISKTCAYLTPDLWKDTLLTKSPFQEFTDHLVKTHTRVSVQRAQAPAVVSI
Download sequence
Identical sequences G1Q568
ENSMLUP00000018851 ENSMLUP00000018851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]