SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018889 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018889
Domain Number 1 Region: 29-73
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000327
Family Elafin-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018889   Gene: ENSMLUG00000023231   Transcript: ENSMLUT00000026863
Sequence length 76
Comment pep:novel scaffold:Myoluc2.0:AAPE02067454:3144:4166:-1 gene:ENSMLUG00000023231 transcript:ENSMLUT00000026863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGTVFVLVAFVILGMEMAFAQRRNGGESRPGLCPNLAKGTLGLCAEWCTGDESCPTGM
KCCSNGCGHVCKPAVH
Download sequence
Identical sequences G1Q5A6
ENSMLUP00000018889 ENSMLUP00000018889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]