SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018955 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000018955
Domain Number - Region: 14-99
Classification Level Classification E-value
Superfamily PH domain-like 0.000492
Family Pleckstrin-homology domain (PH domain) 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018955   Gene: ENSMLUG00000023915   Transcript: ENSMLUT00000025010
Sequence length 102
Comment pep:novel scaffold:Myoluc2.0:GL429819:3955668:3973573:1 gene:ENSMLUG00000023915 transcript:ENSMLUT00000025010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPSSTSSPCPLPEEIRNLLADVEAFVTDILKGENLSKKAKEKRESLIKKIKDVKSTFF
SDSFTGDAEDGEEYDDPFSGAPDTISLASERYDKDDEAPSDG
Download sequence
Identical sequences G1Q5H2
ENSMLUP00000018955 ENSMLUP00000018955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]