SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019003 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019003
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-41
Family Necap1 N-terminal domain-like 0.00000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019003   Gene: ENSMLUG00000029700   Transcript: ENSMLUT00000028694
Sequence length 248
Comment pep:novel scaffold:Myoluc2.0:GL430487:4862:14747:-1 gene:ENSMLUG00000029700 transcript:ENSMLUT00000028694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAEWQLDQPSWSGRLRITAKGQVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRY
FVIRIEDENGRRAFIGLGFGDRGDAFDFNVALQDHFKWVKQQFEFAKQAQNPDQGPKLDL
GFKEGQTIKLNIANMKKKEGATGTPRARPASTGGLSLLPPPPGAKPSTLIPPPGEQLSVE
GSLAQPAVAPGSVAGAPSDLATSVGGATVSWPQPTPATTATADIWGDFAKSTGATSSQTQ
PGTDWVQF
Download sequence
Identical sequences G1Q5M0
ENSMLUP00000019003 ENSMLUP00000019003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]