SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019012 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019012
Domain Number 1 Region: 125-290
Classification Level Classification E-value
Superfamily PH domain-like 5.74e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019012   Gene: ENSMLUG00000025382   Transcript: ENSMLUT00000025665
Sequence length 359
Comment pep:novel scaffold:Myoluc2.0:GL429777:3898169:3965550:1 gene:ENSMLUG00000025382 transcript:ENSMLUT00000025665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLKISLIGHRKRILASLGDRLHEDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTG
GSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQQSSVCEIWTNQNAGFPFSAIHQV
HNTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTES
TQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDP
EDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSST
LPESFENKPSKPIPKPRVSIRKSVIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences G1Q5M9
ENSMLUP00000019012 ENSMLUP00000019012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]