SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019238 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019238
Domain Number 1 Region: 182-236
Classification Level Classification E-value
Superfamily SH3-domain 0.00000289
Family SH3-domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019238
Domain Number - Region: 116-159
Classification Level Classification E-value
Superfamily SH3-domain 0.00112
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019238   Gene: ENSMLUG00000024492   Transcript: ENSMLUT00000024276
Sequence length 360
Comment pep:novel scaffold:Myoluc2.0:GL431193:55129:56271:1 gene:ENSMLUG00000024492 transcript:ENSMLUT00000024276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVTVIGAKLPKMTRNLINIKMNQHMWLLNDSKMWWRVRRWPTGQTMVLSIYMERKNGL
KKGSLMKNLKNTLSLGNTKRKTSMWDSSLIPYTDAEYPAKGEVANRIYDLNILDFVKFAY
MTERLGDLSLVKGSCVTALETCSNGWMWQLQRAVGPVPFQQHPEEVGSWPPSSKLTQLAE
GLIPCVLHVVHKVYLFSLATEKLKFEKGETVKVIEKPGNDQERWKCKNAWGQAGLVHPTM
WWCSAMGLPCPHCMPHTSATRGRGSGCFADREWYYGNTHHQARCVLNRGAGGDILIGEGE
SSPSDLVSLIAPGKNEHYKLQLVKSVNCITQQQFPTMDLLKGPHPHRGHGEKLYLIRALQ
Download sequence
Identical sequences G1Q6A5
ENSMLUP00000019238 ENSMLUP00000018134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]