SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019375 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019375
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-30
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 
Domain Number 2 Region: 105-187
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000279
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019375   Gene: ENSMLUG00000024591   Transcript: ENSMLUT00000026359
Sequence length 211
Comment pep:novel scaffold:Myoluc2.0:GL430163:670249:682075:-1 gene:ENSMLUG00000024591 transcript:ENSMLUT00000026359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPDWASYKLGVFICLNCSGVHRNFPDISKVKSLRLDFWDDSVVEFMTHNGNLRVKAKYE
ARVPAFYYIPQASDCLVLKEQWIRAKYERQEFMADGKTISLSGNREGFLWKRGRDNAQFL
RRRFVLLAREGLLKYYTKEEGKAPRCLIHIKDLNATFQTEKIGNPHGLQITYRREGHIRN
LFVYHESGKVSCLASHPRALQAQRLTLLRSA
Download sequence
Identical sequences G1Q6P2
ENSMLUP00000019375 ENSMLUP00000019375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]