SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019394 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019394
Domain Number 1 Region: 286-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-55
Family SPRY domain 0.000056
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily RING/U-box 5.41e-20
Family RING finger domain, C3HC4 0.0035
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000124
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019394   Gene: ENSMLUG00000029930   Transcript: ENSMLUT00000024581
Sequence length 467
Comment pep:novel scaffold:Myoluc2.0:GL429776:939762:941165:1 gene:ENSMLUG00000029930 transcript:ENSMLUT00000024581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEGAVAKLQTEINCPICLGNLGDPVTTECGHNFCRFCIQHTWADVQDRFPCPVCRHPC
KERHLWSNTQLGRMVDMAKLLQITGAEMKQHEERRLCEKHNQALTLFCEEDLKLLCPLCT
QPPDHQGHQVRPGEEAASNHRQKLRSYIEPLKEQLADLQKLLATQDRQRSELREKVEKRR
AKLACEYESVIASIECEQAAVHSRLAAQEKHILRNLTANKATFSDHISKLRGLRKEMAET
SVVSDVKLLMNIKSVLHRCDNLEPPDVYCLKYKREFSLPPQCSALLQIMQTFREEVTLDP
ETAHPHLLVSADKKSVTFVRKKQGIHRNPKGFADNAVVLGSEGFDCGRHYWEVQVDDKPE
WAVGVCKDSPSKERKQPLLRQENRCWTIQLQDGDYVARGPVPVTLVLQEMPRGIGIYLDY
EMGHVSFYSWNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD
Download sequence
Identical sequences G1Q6R1
ENSMLUP00000019394 ENSMLUP00000019394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]