SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019414 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019414
Domain Number 1 Region: 798-1005
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000765
Further Details:      
 
Domain Number 2 Region: 310-592
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-47
Family FCH domain 0.012
Further Details:      
 
Domain Number 3 Region: 726-779
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019414   Gene: ENSMLUG00000023668   Transcript: ENSMLUT00000027994
Sequence length 1158
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430150:523355:535292:-1 gene:ENSMLUG00000023668 transcript:ENSMLUT00000027994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRKKRELMKTPSISKKNRAGSPSPQPSGSYSQSVKQDPKEEGERWYMTIPTGRDPPES
EPSGGGGGETEVDTDTPNPVGSRQGKGSTYVLSRPTRHRDRRPTGVRAVIPAGPQASWVL
ASSCPLPLQTLCCPGQQPIFPPGDRIFEEYMGRLSLGPPTPSLLIPALPADLLEARRPLA
HECLGEALRVMRQVICKYPLLNTVETLTAAGTLIAKVKAFHYECNNEADKQEFEKALETI
AVSFSSTVSEFLMGEVDSSTLLSVPPGDSSQSMENLYGQGSEGALPCAEDCDAGCLLPEE
VDMLLQRCEGGVDVALNYAKNMAKYMKDLIGYLEKRTALEMDFAKGLQKIVHNCRQSVMQ
EPHMPLLSIYSLALEQDLEFGHGLAQAVITLQTQTFMQPLNLRRLEHEKRRKEIKESWHR
AQRKLQEAESNLRKAKQGYVQRCEDHDKARLLVAKTEEEQVGTGPGAGGTVSKALDKRRR
LEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYY
QMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDEEPDVHYDFEPHVPTSNWSP
VMRARKGSFNVGDAAEAASGPPDEGGPSDGMLAKERRGGRGHQVHKSWPTSIPDSDGSLD
PSPGSGDFKKFERMSSSGTMSSSEELVDQEGSAGASAFEQADLNGMTPELPVAVPSGPFR
HMGLSKAARTHRLRKLRSPAKCRECNSYVYFHGAECEECCLACHKKCLETLAIQCGHKKL
QGRLQLFGQDFGQAARGTPDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAF
ENGKELVELSQASPHDISNVLKLYLRQLPEPLISFRLYHELVGLAKDSLKAEAEAKAASR
NCPDTAESEAVAMAMVGRLRELLRDLPSENKASLQYLLQHLRRIVEVEQDNKMTPGNLGI
VFGPTLLRPRPTEATVSLSSLVDYPHQARIVETLITHYDLVFEEKPEENRGQYGMPTQRA
EVLLQVPYSEANEEAAFPLQEEAEDGGPDLPESHVASNDSDSELEEAPELLSPAEGGALH
HLSFLEKQGSEASAEEAGDSGSEEQLGPSAGEDGDWEGLSQYNTNQSNNVAESPLPAMKH
GDRHVIAGTGSESRPEFV
Download sequence
Identical sequences G1Q6T1
ENSMLUP00000019414 ENSMLUP00000019414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]