SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019431 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019431
Domain Number 1 Region: 6-63
Classification Level Classification E-value
Superfamily beta-catenin-interacting protein ICAT 7.85e-27
Family beta-catenin-interacting protein ICAT 0.0000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019431   Gene: ENSMLUG00000029404   Transcript: ENSMLUT00000030087
Sequence length 63
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430425:145651:146287:-1 gene:ENSMLUG00000029404 transcript:ENSMLUT00000030087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPQHSI
DQG
Download sequence
Identical sequences G1Q6U8
ENSMLUP00000019431 ENSMLUP00000019431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]