SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019445 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019445
Domain Number 1 Region: 105-174
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.91e-18
Family SAM (sterile alpha motif) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 23-123
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000538
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019445   Gene: ENSMLUG00000025593   Transcript: ENSMLUT00000030040
Sequence length 226
Comment pep:novel scaffold:Myoluc2.0:AAPE02067082:858:8425:-1 gene:ENSMLUG00000025593 transcript:ENSMLUT00000030040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDI
ISKPPMGTWMGLLNNKVGTFKFIYVDVLNEEEEKPKRPTRRKRKGRPPQPKSVEDLLDRI
NLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDKPQPEIC
TGGNSDQSGSQEKLLIDSQALSGCSPRDSGCYESSENLENGNVGTD
Download sequence
Identical sequences G1Q6W2
ENSMLUP00000019445 ENSMLUP00000019445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]