SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019452 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019452
Domain Number 1 Region: 316-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-86
Family Protein kinases, catalytic subunit 0.00000167
Further Details:      
 
Domain Number 2 Region: 131-231
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 6.8e-46
Family MAST3 pre-PK domain-like 0.0000141
Further Details:      
 
Domain Number 3 Region: 891-988
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-18
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019452   Gene: ENSMLUG00000001587   Transcript: ENSMLUT00000023341
Sequence length 1274
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429989:695745:730400:-1 gene:ENSMLUG00000001587 transcript:ENSMLUT00000023341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSTGNSPLDSPRNFSPNAPAHFSFVPARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSS
QEKLHQLPFQPTADELHFLTKHFSTESVPDEEGRQSPAMRPRSRSLSPGRSPVSFDSEII
MMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPLADGALSFIHHQVIEMARDCLDKSR
SGLITSQYFYELQENLEKLLQDAHERSESSEVAFVMQLVKKLMIVIARPARLLECLEFDP
EEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLGLTRDPLEEMAQLSSYDSPDTPETDDSV
EGRGASLTSKKAPCEEDFETIKLISNGAYGAVFLVRHKSTRQRFAMKKINKQNLILRNQI
QQAFVERDILTFAENPFVVSMFCSFETKRHLCMVMEYVEGGDCATLLKNIGALPVDMVRL
YFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIGLMSLTTNLYEGHIE
KDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELF
GQVISDEIVWPEGDDALPPDAQDLTSKLLHQNPLERLGTGSACEVKQHPFFTGLDWTGLL
RQKAEFIPQLESEDDTSYFDTRSDRYHHVDSEDEEEVSEDGCLEIRQFSSCSPRFSKVYS
SMERLSLLEERRTPPPTKRSLSEEKEDRSDGLAGLKGRDRSWVIGSPEILRKRLSVSESS
HTESDSSPPLTVRRHCSGLLDVPRFPEGPEEATSTPRRQQQEGIWLLTPTSAEGMSEPIP
ERPVEQQLKLDEEPASQSSGSSPGVAQQVAKGPRLDHNAGRQGGAARRDSIEKRTTRPIS
KVIKSASATALSLLIPTEHHTCSPLASPMSPHSQSSNPSSRDSSPSRDFLPALSNSRTPI
IIHRAGKKYGFTLRAIRVYMGDLDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPV
HGLVHTEVVELILKSGNKLSISTTPLENTSIKVGPARRGSYKAKMARRSKRSRGKDGQES
RKRSSLFRKITKQASLLHTSRSLSSLNRSLSSGESGPGSPTHGHSLSPRSPTQGYRVTPD
AVHSDRRQPLSSSPSSSVPSSPAGSGHTRPSSLHGLAPKLQRQYRSPRRKSAGSIPLSPL
AHTPSPPPAASPQRSPSPLSGHGTQALPEPPRSPLLKRVQSAEKLVAGTRSVLSGKGVLP
GKGVLQPAPSRALGTLRQDRAERRESLQKQEAIREVDSSEDDADEGPENSQGLIPTSGPP
ASSTPGGPGPWSWK
Download sequence
Identical sequences G1Q6W9
ENSMLUP00000019452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]