SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019471 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019471
Domain Number 1 Region: 88-310
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.16e-37
Family TehB-like 0.095
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019471
Domain Number - Region: 16-68
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.0667
Family Retrovirus capsid protein, N-terminal core domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019471   Gene: ENSMLUG00000028321   Transcript: ENSMLUT00000024253
Sequence length 519
Comment pep:novel scaffold:Myoluc2.0:GL429871:3524712:3526268:1 gene:ENSMLUG00000028321 transcript:ENSMLUT00000024253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIKSKANCAQNPNCNIMIFYPTKEEFNDFDKYIASIESQGAHRAGLAKIIPPKEWKAR
QTYDDVNDMVIANPLQQVASGRAGVFIQYHKKKRAMTVGEYRLLANSGQYQTPPHLDFED
LERKYWKTRLYDSPIYGADISGSLFDANTKQWNLGHLGTIQDLLEQECGVVIEGVNTPYL
YFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWYAVPPEHGQRLERLARELFPGSSRGCEA
FLRHKVALISPTVLKENGVPFSRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRW
IDYGKVASQCSCGEARVSFSMDVFVRILQPERYELWKRGQDRTVVDHAEPTAPGSQELSV
WREGRAAWRSALGLRHLQPHQATHTPRSVGTGRGSRGHRGSRALVRQPSLCPSLGRGSAS
VAQPAAAAALCSSKPDPSSQPTQDLQPTGTRGRGRGRGRGRRGRGGGRRPREQGTQESIV
QAPAKRRHLVGAVRTAPDPKAQPVPEDKPSMDSPALLVP
Download sequence
Identical sequences G1Q6Y8
ENSMLUP00000019471 ENSMLUP00000019471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]