SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019479 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019479
Domain Number 1 Region: 60-218
Classification Level Classification E-value
Superfamily Ferritin-like 5.75e-38
Family Ferritin 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019479   Gene: ENSMLUG00000027805   Transcript: ENSMLUT00000029219
Sequence length 225
Comment pep:novel scaffold:Myoluc2.0:GL429774:10969306:10971659:-1 gene:ENSMLUG00000027805 transcript:ENSMLUT00000029219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPCSRFFKRKSVSIMLLIATRLKYEAGAAREAWVPGARGKPVPAAGGRKAYPCTNFVHW
TSSQASPTQVRQNYHQDQEASSNHQINLELYAPYIYLPMSYYFGREDVALKNFVKYFLYQ
SHEKGERAQKLMKLQIQRVGGIFLQDIMQTENGLNAMECALHLEKILELHKLATVKNDPY
LYDFNEFNEEVKTKLCKMPSPPPQFGTAEYLFDKHTLGDSDESHG
Download sequence
Identical sequences G1Q6Z6
ENSMLUP00000019479 ENSMLUP00000019479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]