SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019481 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019481
Domain Number 1 Region: 2002-2197,2237-2378
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.35e-35
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.069
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019481
Domain Number - Region: 1691-1721
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000795
Family TFIIH p44 subunit cysteine-rich domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019481   Gene: ENSMLUG00000025318   Transcript: ENSMLUT00000022661
Sequence length 2389
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429829:2848501:2906501:-1 gene:ENSMLUG00000025318 transcript:ENSMLUT00000022661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDIDSLNPVLRDNPQLQEEVKIWVKEQKVQEIFMQGPYSLNGYRVRVYRQDSATQWFTGI
ITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRASQN
SNAVHGHYTRAQANSPRPTMNSQAAVPKQNTHQQQRNIRSNKRKGSDSSIPDEEKMKEEK
YDYIGRGENPKGKNKQLVNKRRKPEEDEKKLNMKRLRTDNVSDFSENSDSENPNKRIINN
SLEQKPENELKNKNTSKINGEEGKFQNNEKTGEETLIDSQPPWDQIQGDKKHEEVEKQKF
VDSQLQEKMIIHSSEQTTLSDHNPNDLLLQENTEKTHTVELPKEQFVSRPSTPKCVIDIT
NDTNSEKVVQENSNTFGLQTLQKMDSNVSDSKHSIVNAKYLEASKQDSDHSWISDIVKVD
LTQSNVKNAPSGNDHLNMEKEKNQYASYTSSVSSGSVMDDKLRKRSPPPEIIKSKLNASV
DGHKTKSNPSPEVVKPKITHSPDSVKSKATYVNSHTAGERRLANKIEHELSRCSFHPVPT
RGSTLETTKSPLIIDKNEHFTVYRDPALIGSETGANHISPFLNQHPFSLHSSSHRTCLNP
GTHHPALTPATHLLAGSSSQTPLPTINSHPLTSGPHHSVHHPHLLPAVLPGVPTASLLGG
HPRLETAHASSLSHLALAHQQQQQLLQHQSPHLLGQAHPSASYSQLGLYPIIWQYPNGTH
AYSGLGLPSSKWVHPENAVNAESSLRRNSPSSWLHQPTPVTSADGIGLLSHIPVRPSSAE
PHRPLKITTHSSPPLAKSLVDHHKEELERKAFIEPLRSITSASAKNDLELTRSQTGKDGH
LHRHFVDPVMNPLQRPPQETGERLNKYKEEHRRILQESIDVAPFTTKIKGLEGERDNYSR
VASSSSSPKSHVIKQDKDMECSVSDLYKMKHSVPQSLPQSNYFTTLSNSVVNEPPRSYPS
KEVSNIYTEKQNNTLVAATNPQTLTSFISSLSKPPPLIKHQPESEGLVGKIPEHLSHQIA
SHSVTTFRNDCRSPTHLTVSSTNTLRSMPALHRAPVFHPPIHHSLDRKESSYSSLSPPTL
TPVMPVNAGGKVQESQKPPTLIPEPKESQANFKSSSEQSLTEMWKSNNNPSKEKAEWHVE
KSSGKSQAAMASVIVRPPSSTKLDSVPAMQLTSKDRVSERSSAEANQTDCLKPAEAGEIG
RIILPSVNSDSAHIKSAKNFQAVSQGSVPSSVVSAVNTMCNTKMDIFTSAATTTSISSWS
GSGIIYSLSNTILPSKSSDCTSSKSVSHSVAHTQECKVSTTAPVTPASSKTGSAVQPSSG
FSGTTDFIHLKKHKAALAAAQYKSSNASETEPNAVKNQTSSASLVLDSTVVCNTINKANS
VGNGQASQTNQPNYHTKLKKAWLTRHSEEDKNTNKMENSGNSVSEIIKPCSVNLIASTSN
DIQNSVDSKIIVDKYVKDDKVNRRKAKRTYESGSESGDSDESESKSEQRTKRQPKPTYKK
KQNDLQKRKGEIEEDLKPNGVLSRSAKEKSKLKLQSNSSAGIPRSVLKDWRKVKKLKQTG
ESFLQDDSCCEIGPNLQKCRECRLIRSKKEEEPTHSPVFCRFYYFRRLSFSKNGVVRIDG
FSSPDQYDDEAMSLWTHENYEDDELDIETSKYILDIIGDKFCQLVTSEKTALSWVKKDAK
IAWKRAVRGVREMCDACEATLFNIHWVCQKCGFVVCLDCYKAKERKSSRDKELYAWIKCV
KGQPHDHKHLMPTQIIPSSVLTDLLDVMHTLREKYGIKSHCHCTNKQNIQVGNFSTMNGV
SQVLQNVLNHSNKISLCMPESQQQNTPQKSEGNGSSSPGSDVSTDSKLSPPESQSPLHWL
ADLAEQKSREEKKENKEFALEKQIKEEREQDSPDSPNSRSSPPVSQNNEQGSTLRDLLTT
TAGKLRVGSTDAGIAFAPVYSMGTPSGKSGRTMPNILDDIIASVVENKIPPNKATKINVK
PDLKEEPRESRKSAMDENKLFSDIPHSWICEKHILWLKDYKNTNNWKLFKECWKHGQPAV
VSGVHKKMNMSLWKSESISLDFGDHQADLLNCKDSITSNGNVKEFWDGFEEVSKRQKTKS
GETVVLKLKDCPSGEEFKTMMPARYEDFLKSLPLPEYCNPEGKFNLASHLPAFFVRPDLG
PRLCSAYDTGVAAAKDHDIGTTNLHVEVSDVVNILVYVGIAKGNGILSKAGILKKFEEED
LDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYV
NKKLRQRLLEEYGVRTCTLVQFLGDAIVLPAGTLHQVQNFHSCIQVTEDFVSPEHLVQSF
HLTQELRLLKDEINYDDKLQVKNILYHAVKEVVRALKIHEDEAEDMEEN
Download sequence
Identical sequences G1Q6Z8
ENSMLUP00000019481 ENSMLUP00000019481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]