SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019486 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019486
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.65e-29
Family Ubiquitin-related 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019486   Gene: ENSMLUG00000028601   Transcript: ENSMLUT00000027325
Sequence length 98
Comment pep:novel scaffold:Myoluc2.0:GL430058:695653:700201:-1 gene:ENSMLUG00000028601 transcript:ENSMLUT00000027325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPI
NEADTPAQLEMEDEDTIDVFQQQTGGSRATGCLLGCGL
Download sequence
Identical sequences G1Q703
ENSMLUP00000019486 ENSMLUP00000019486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]