SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019590 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019590
Domain Number 1 Region: 26-79
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000017
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019590   Gene: ENSMLUG00000027740   Transcript: ENSMLUT00000025564
Sequence length 83
Comment pep:novel scaffold:Myoluc2.0:GL429796:5795850:5799674:-1 gene:ENSMLUG00000027740 transcript:ENSMLUT00000025564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRLLLFGAALTLALAQASAFRNDKCGNTIKIENPGYLTSPGYPHSYHPSEKCEWLIQA
PEPYQRIMINFNPHFDLEDRDCK
Download sequence
Identical sequences G1Q7A7
ENSMLUP00000019590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]