SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019628 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019628
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.01e-71
Family Mammalian PLC 0.000000151
Further Details:      
 
Domain Number 2 Region: 480-543,584-725
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 4.58e-63
Family C-terminal domain of PLC-beta 0.0000749
Further Details:      
 
Domain Number 3 Region: 261-379
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.13e-24
Family PLC-like (P variant) 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019628   Gene: ENSMLUG00000024494   Transcript: ENSMLUT00000023721
Sequence length 726
Comment pep:novel scaffold:Myoluc2.0:GL429809:4607:64140:1 gene:ENSMLUG00000024494 transcript:ENSMLUT00000023721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEG
SSKKKLSEQVSNTCSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMA
TEEMSNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSR
IYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMR
RPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTK
TSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICL
RNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEE
DVKKEPDPGETSSEALSEAGTTPAENGVNHTTSLAPKPPSQAIHSQPAPGPGKAPAKTED
LIHSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKELVKRHHKKTTDLIKEHTTKYNEIQ
NDYLRRRAALEKTARKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQL
LNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKR
QEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQIL
DEKPKV
Download sequence
Identical sequences G1Q7E5
ENSMLUP00000019628 ENSMLUP00000019628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]