SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019635 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019635
Domain Number 1 Region: 160-260
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000027
Further Details:      
 
Domain Number 2 Region: 12-112
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-28
Family Phosphotyrosine-binding domain (PTB) 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019635   Gene: ENSMLUG00000000967   Transcript: ENSMLUT00000000964
Sequence length 1231
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:23917032:23920727:-1 gene:ENSMLUG00000000967 transcript:ENSMLUT00000000964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTETEGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKSH
HDGASAPGTGGGGGSCSGSSGVGEAGEDLSFGDSNPGPAFKEVWQVVLKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNTEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
EDSVVAQSMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASLVGGKQGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GCSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPN
GHYILPRSGNGHRYLPATGLGTNSALAGDEAASAADLDNRFRKRTHSAGTSPTISHQKTP
SQSSVASIEEYTEMMPACPPGGGSGGRLPGYRHSAFLPTQSYPEEGLEMHPLERRGGHSR
PDTSTLHTDDGYMPMTPGVAPVPGSRKGSGDYMPMSPKSVSSPQQIINPLRRHPQRVDPN
GYMMMSPSGSSSPDTGGGPSSSNSAAPSRSSYGKLWTNGVGGHHAHPLPPSKLPSESSGG
KLLPCTGDYMNMSPVGDSNTSSPSDCYCGPEDPQHKSVLSYCSLPRSFKHTQRPGDLEET
ARHQHLRLSSSSGRLLYAAAAEDSSSSTSNDSLGGGYCGVRPEPSLPQHLHHQVLQSHLP
RKVDSAAQTNSRLARPTRLSLGDPKASTLPRAREQQQPALLLPPEPKSPGEYVNIEFGSD
QPGYLSGPVASHSSPSVRCPSQLQPAPREEESGTEEYMNMDLGPGRRATWQESPVVQLSR
VGPAPPGTASTCRPTRAVPSTSTRGDYMTMQMGCPHQSYVDTSPVAPVSYADIRTGIVEE
ASLPGAIAAAPSSSSTASASPTAPQGAGELVAPQGSGGTSAFTRVNLSPSGNQSAKVIRA
DPQGCRRRHSSETFSSMPSTPRAGNMVPSGGAAVGGSSGGSSSIEDVKRHSSASFENVWL
RPGELGGAPKEQAQVCGAAGGLENGLNYIDLDLVKDFKQHPQEHPRQVQHPQPPTLRHPP
GSSESSSTSRSREDVSAYASISFQKQPEDLQ
Download sequence
Identical sequences G1Q7F2
XP_006082648.1.53796 ENSMLUP00000019635 ENSMLUP00000019635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]