SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019637 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019637
Domain Number 1 Region: 35-100
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.41e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 
Domain Number 2 Region: 104-162
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000139
Family BCR-homology GTPase activation domain (BH-domain) 0.0000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019637   Gene: ENSMLUG00000029633   Transcript: ENSMLUT00000022413
Sequence length 163
Comment pep:known_by_projection scaffold:Myoluc2.0:AAPE02062787:2161:17770:-1 gene:ENSMLUG00000029633 transcript:ENSMLUT00000022413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPKPPLPSSTGDTPCSPRNCGWKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWC
EYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNQ
RPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRGG
Download sequence
Identical sequences G1Q7F4
ENSMLUP00000019637 ENSMLUP00000019637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]