SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019653 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019653
Domain Number 1 Region: 96-173
Classification Level Classification E-value
Superfamily TAZ domain 0.000000000000105
Family TAZ domain 0.0000206
Further Details:      
 
Domain Number 2 Region: 21-65
Classification Level Classification E-value
Superfamily RING/U-box 0.00000033
Family ZZ domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019653   Gene: ENSMLUG00000023083   Transcript: ENSMLUT00000029701
Sequence length 544
Comment pep:novel scaffold:Myoluc2.0:GL430075:979948:982362:1 gene:ENSMLUG00000023083 transcript:ENSMLUT00000029701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHEDKESSLAMLLQVHSQGQDGCVLACTECKQRVETGWHCPCQDYDLCINCYNTKGHTHK
MVKVGLGLDEEAEEAEEGDEGGNQGEMQLKNLPKFRRLSILRCIQSLRHARQCGDTNCSD
CQKLKRVVLHTTRCLRKAFGGCPVCKQLFALCCYHAKQCQENPCPPFCLNIKQKLREQRL
RRRQQRIGNRLLQADATMNSCNVPQPSAIPSAPPWTPPQQPNTPQTPQPPTQSQPWPVSM
SLAGFFSSALAPPVSTGKPTNLQLQPSLQNLKAMQASGPRPAVPPQQQMGGLNPKGQALN
IMNPGRNPSMARMNNHREMPQQEQQQEQQEQQQQQEGSAGMAAGLGHAQFQQPQQQQIQQ
QIGSQASQTVLGPNSAQFFLLSQLEAPVLSAVSCYSHFRCHRRQLSRSEQVRQKIKKHGP
NTPHEPQQHMLSESHRPLLPGQQMAICLSSQVRSQAPVPSRLQSQPPHSSPSPWIPQPSP
HHLSPQTGSPHPGLPVTMASSIDQGHLGNPKYTMLPQLNTPRSALPSELSLIGDTTIDTL
EKFV
Download sequence
Identical sequences G1Q7H0
ENSMLUP00000019653 ENSMLUP00000019653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]