SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019775 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019775
Domain Number 1 Region: 293-488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-46
Family SPRY domain 0.0000576
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily RING/U-box 2.05e-26
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 89-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.26e-17
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019775   Gene: ENSMLUG00000025861   Transcript: ENSMLUT00000027334
Sequence length 490
Comment pep:novel scaffold:Myoluc2.0:GL429905:2939308:2947403:1 gene:ENSMLUG00000025861 transcript:ENSMLUT00000027334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILMNMKEEVTCPICLELLTEPMSLDCGHTFCQACITANNRGSIIGQGESCCPVCRI
SYQPENLRPNRHVANIVEALRKVKLSPKEEQKSDLCVHHGEKLLLFCQEDEKIICWLCER
SRDHRGHHTFLMEEIAQEYKEKLQAALDRLKAEQQKAEKLDDDLEEERTSKKDQIEHERK
SVLYYFRELRGILAREQQKELQRLEKEAAENHDDLVQAESELAQQKKLLRDLISDLEHRL
QGSAVEMLQDVKGIMERSKTFTLKKPKTLPMKQRRVFRAPDLGGMLQVFNELTDVRHYWV
HVTLDPPTDKSYNVISEDRRQVRSLPLLYIIADKTNFGVLGSPSITSGKHYWEVDVSQKC
AWIMGVYGEKYPDSNRMDFLRQIINSQPLCSIFQPQYGYWVIGLQNHSEYKAFVDSDFSN
PKTLTLFLSVPPRRVGVFLDYDAGTVSFFNVTNGGLLIYKFSSCSFSQKMFPYFNPMKCT
APMTLCSPSS
Download sequence
Identical sequences G1Q7U2
ENSMLUP00000019775 XP_014316240.1.53796 ENSMLUP00000019775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]