SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019792 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019792
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.9e-67
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019792   Gene: ENSMLUG00000024057   Transcript: ENSMLUT00000022639
Sequence length 163
Comment pep:novel scaffold:Myoluc2.0:GL429768:23166160:23166651:1 gene:ENSMLUG00000024057 transcript:ENSMLUT00000022639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVYLDTADGEPLGRISLELFADKIPKTAENSRVLTTGEKGFGYKVSCFHRIIPGFM
CQGGDFTRHNGTGGKSIYGEKFEDENFMLKHTGPGILSMANAGPNTNGSQFFIRAAKTEW
LDGKHVVFGQGREGMDIVTAMERFGSRNGKTSKKITIADCGQL
Download sequence
Identical sequences G1Q7V9
ENSMLUP00000019792 ENSMLUP00000019792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]