SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019797 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019797
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.37e-34
Family Ubiquitin-related 0.0000225
Further Details:      
 
Domain Number 2 Region: 76-127
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 9.7e-19
Family Ribosomal protein L40e 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019797   Gene: ENSMLUG00000027508   Transcript: ENSMLUT00000029509
Sequence length 128
Comment pep:novel scaffold:Myoluc2.0:GL429835:4210280:4210722:1 gene:ENSMLUG00000027508 transcript:ENSMLUT00000029509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLAVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLVQKYNCDKMICRKCYARLHPRAVNCRKEKCGHTNN
LRPKKKVK
Download sequence
Identical sequences G1Q7W4
ENSMLUP00000019797 ENSMLUP00000019797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]