SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019800 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019800
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-20
Family Ubiquitin-related 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019800   Gene: ENSMLUG00000029259   Transcript: ENSMLUT00000022902
Sequence length 95
Comment pep:novel scaffold:Myoluc2.0:GL429794:1880350:1880637:-1 gene:ENSMLUG00000029259 transcript:ENSMLUT00000022902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGRSSPEGVKTENNDHINMKVAGQDGSGVQAKIQRRTPLSKLRKAYCEPQGLSRRQIGF
RFDGQPINETDTPAQLGGEDEDTTGVFQQQTAGVC
Download sequence
Identical sequences G1Q7W7
ENSMLUP00000019800 ENSMLUP00000019800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]