SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019846 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019846
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily Ferritin-like 1.3e-73
Family Ferritin 0.0000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019846   Gene: ENSMLUG00000025726   Transcript: ENSMLUT00000030912
Sequence length 183
Comment pep:novel scaffold:Myoluc2.0:GL431228:41114:43161:1 gene:ENSMLUG00000025726 transcript:ENSMLUT00000030912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAMSTAPASQVRQNYHQDSEAAINRQINLEYASYVYLSMVYYFDRDDVALKNFAKYFLH
QSHEEREHAEKLMKLQNQGGRIFLQDIKKPDRDDWENGLNAMECALHLEKSVNQSLLDLH
KLATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRRLGAPEAGMAEYLFDKHTLGDS
DES
Download sequence
Identical sequences G1Q813
ENSMLUP00000019846 ENSMLUP00000019846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]